.webp "How To Install/Run – Streamlining OSINT Workflows For Enhanced Capabilities")
Fibratus : Tool for Exploration & Tracing of the Windows Kernel
Fibratus is a tool which is able to capture the most of the Windows kernel activity - process/thread creation and termination, context switches, file system I/O, registry, network activity, DLL loading/unloading and much more. The kernel events can be easily streamed to a number of output sinks like AMQP message brokers, Elasticsearch clusters or standard output stream. You can use filaments (lightweight Python modules) to extend...
Kaboom : Script That Automates The Penetration Test
Kaboom is a script that automates the penetration test. It performs several tasks for each phases of pentest: Information gathering TCP scanUDP scanVulnerability assessment It tests several services:smbsshsnmpsmtpftptftpms-sqlmysqlrdphttphttpsand more...It finds the CVEs and then searchs them on exploit-db or Metasploit db.Exploitation brute force ssh Also Read : Pftriage : Python Tool & Library To Help Analyse Files During Malware Triage...
Crashcast-Exploit : Tool To Mass Play YouTube Video, Terminate Apps & Rename Chromecast Device
CRASHCAST mass-exploit tool allows you to mass play any YouTube video, remotely terminate apps, and rename Chromecast device(s) obtained from Shodan.io. Prerequisites The only thing you need installed is Python 3.x sudo apt-get install python3 You also require to have cURL installed sudo apt-get install curl You also require Shodan python module pip install shodan Also Read : SSRFmap : Automatic SSRF Fuzzer And Exploitation...
Top 5 DDoS Attacking Tools For Linux,Windows & Android
DDOS or Distributed Denial of Service Attack is the most strong version of DOS attack. In this, many computers are used to target same server in a distributed manner. Where DOS (Denial of Service Attack) is one of most dangerous cyber attacks. It is a an attempt to reduces, restricts or prevents or blocks accessibility of resources to...
Pftriage : Python Tool & Library To Help Analyse Files During Malware Triage & Analysis
Pftriage is a tool to help analyze files during malware triage. It allows an analyst to quickly view and extract properties of a file to help during the triage process. The tool also has an analyse function which can detect common malicious indicators used by malware. Also Read : ADAPT : Tool That Performs Automated Penetration Testing for WebApps Dependencies pefilefilemagic Note: On...
SSRFmap : Automatic SSRF Fuzzer And Exploitation Tool
SSRF are often used to leverage actions on other services, this framework aims to find and exploit these services easily. SSRFmap takes a Burp request file as input and a parameter to fuzz. Note : Server Side Request Forgery or SSRF is a vulnerability in which an attacker forces a server to perform requests on their behalf. Also...
LeakLooker : Find open databases with Shodan
LeakLooker can be used to find open MongoDB, CouchDB and Elasticsearch database, it also includes Kibana instances. Script parses results from Shodan, excluding empty and compromised databases. Everything is sorted and presented in clickable way. Requirements Python 3Shodan paid plan, except Kibana search Put your Shodan API key in line 65 pip3 install shodanpip3 install coloramapip3 install hurry.filesize Also Read : CIRTKit : Tools...
Malice : VirusTotal Wanna Be – Now with 100% more Hipster
Malice mission is to be a free open source version of VirusTotal that anyone can use at any scale from an independent researcher to a fortune 500 company. Try It Out DEMO: demo.malice.ioUsername: malicePassword: ecilam Also Read : CIRTKit : Tools for the Computer Incident Response Team Installation $ brew install maliceio/tap/malice Usage: malice COMMAND Open Source Malware Analysis FrameworkVersion: 0.3.11Author:...
ADAPT : Tool That Performs Automated Penetration Testing for WebApps
ADAPT is a tool that performs Automated Dynamic Application Penetration Testing for web applications. It is designed to increase accuracy, speed, and confidence in penetration testing efforts. ADAPT automatically tests for multiple industry standard OWASP Top 10 vulnerabilities, and outputs categorized findings based on these potential vulnerabilities. ADAPT also uses the functionality from OWASP ZAP to perform automated...
Pwndb : Search For Leaked Credentials
Pwndb is a python command-line tool for searching leaked credentials using the Onion service with the same name. Usage usage: pwndb.py optional arguments: -h, --help show this help message and exit --target TARGET Target email/domain to search for leaks. --list LIST ...
